Lineage for d3p2pa_ (3p2p A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6695Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 6696Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) (S)
  5. 6701Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 6711Protein Phospholipase A2 [48637] (3 species)
  7. 6752Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (9 PDB entries)
  8. 6758Domain d3p2pa_: 3p2p A: [19607]

Details for d3p2pa_

PDB Entry: 3p2p (more details), 2.1 Å

PDB Description: enhanced activity and altered specificity of phospholipase a2 by deletion of a surface loop

SCOP Domain Sequences for d3p2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p2pa_ a.133.1.2 (A:) Phospholipase A2 {Pig (Sus scrofa), pancreas}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlsg
cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc

SCOP Domain Coordinates for d3p2pa_:

Click to download the PDB-style file with coordinates for d3p2pa_.
(The format of our PDB-style files is described here.)

Timeline for d3p2pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3p2pb_