Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.18: Bacterial lipase [53570] (4 proteins) lack the first two strands of the common fold |
Protein automated matches [190277] (9 species) not a true protein |
Species Geobacillus zalihae [TaxId:213419] [187349] (3 PDB entries) |
Domain d3umjb_: 3umj B: [195990] automated match to d1ji3a_ complexed with ca, cl, gol, na, zn |
PDB Entry: 3umj (more details), 2.1 Å
SCOPe Domain Sequences for d3umjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3umjb_ c.69.1.18 (B:) automated matches {Geobacillus zalihae [TaxId: 213419]} slrandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwd raceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarm lvsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrff dlqkavleaaavasnvpytsqvydfkldqwglrrqpgesfdhyferlkrspvwtstdtar ydlsvsgaeklnqwvqaspntyylsfstertyrgaltgnhypelgmnafsavvcapflgs yrnptlgiderwlendgivntvsmngpkrgssdrivpydgtlkkgvwndmgtynvdhlei igvdpnpsfdirafylrlaeqlaslqp
Timeline for d3umjb_: