Lineage for d3vmkb_ (3vmk B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386088Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1386089Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1386090Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1386091Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (10 species)
  7. 1386113Species Shewanella benthica [TaxId:43661] [195907] (1 PDB entry)
  8. 1386115Domain d3vmkb_: 3vmk B: [195908]
    automated match to d1cnza_
    complexed with cl, ipm, mg

Details for d3vmkb_

PDB Entry: 3vmk (more details), 1.48 Å

PDB Description: 3-isopropylmalate dehydrogenase from shewanella benthica db21 mt-2
PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d3vmkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vmkb_ c.77.1.1 (B:) 3-isopropylmalate dehydrogenase, IPMDH {Shewanella benthica [TaxId: 43661]}
hhhhgssyqiavlagdgigpevmaearkvlaavekrfdlsieyseydvggaaidnhgcpl
peatlkgceaadavlfgsvggpkwehlppndqpergallplrghfelfcnmrpaklhpgl
ehmsplrsdisekgfdilcvreltggiyfgkpkgrqgegeneeafdtmrysrkeirriak
iafesaqgrrkkvtsvdkanvlacsvlwrevveevakdypdvelehiyidnatmqllrrp
nefdvmlcsnlfgdivsdeiamltgsmgllasismnsqgfgmyepaggsapdiagqgian
pvaqilsaalllrhslkledaalaieaavskalsdgyltcellpasersqakstsqmgdy
iaqaiaeg

SCOPe Domain Coordinates for d3vmkb_:

Click to download the PDB-style file with coordinates for d3vmkb_.
(The format of our PDB-style files is described here.)

Timeline for d3vmkb_: