SCOPe 2.04: Domain d3zywa_: 3zyw A:

Lineage for d3zywa_ (3zyw A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189547] (6 PDB entries)

8. Domain d3zywa_: 3zyw A: [195905]
   automated match to d2yana_
   complexed with edo

Details for d3zywa_

PDB Entry: 3zyw, 1.84 Å

PDB Description: crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3)

PDB Compounds: (A:) glutaredoxin-3

SCOPe Domain Sequences for d3zywa_:

Sequence; same for both SEQRES and ATOM records:

>d3zywa_ c.47.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnlrlkklthaapcmlfmkgtpqeprcgfskqmveilhkhniqfssfdifsdeevrqgl
kaysswptypqlyvsgeliggldiikeleaseeldticpkaaenlyfq

Timeline for d3zywa_:

• d3zywa_ first appeared in SCOPe 2.02
  
• d3zywa_ appears in SCOPe 2.03
  
• d3zywa_ appears in SCOPe 2.05
  
• d3zywa_ appears in the current release, SCOPe 2.08, called d3zywa1