Lineage for d3zywa1 (3zyw A:132-232)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876477Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries)
  8. 2876482Domain d3zywa1: 3zyw A:132-232 [195905]
    Other proteins in same PDB: d3zywa2, d3zywb2, d3zywb3
    automated match to d2yana_
    complexed with edo

Details for d3zywa1

PDB Entry: 3zyw (more details), 1.84 Å

PDB Description: crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3)
PDB Compounds: (A:) glutaredoxin-3

SCOPe Domain Sequences for d3zywa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zywa1 c.47.1.1 (A:132-232) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlnlrlkklthaapcmlfmkgtpqeprcgfskqmveilhkhniqfssfdifsdeevrqgl
kaysswptypqlyvsgeliggldiikeleaseeldticpka

SCOPe Domain Coordinates for d3zywa1:

Click to download the PDB-style file with coordinates for d3zywa1.
(The format of our PDB-style files is described here.)

Timeline for d3zywa1: