SCOPe 2.08: Domain d2y64a1: 2y64 A:1-166

Lineage for d2y64a1 (2y64 A:1-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.14: CBM4/9 [74893] (4 proteins)

6. Protein automated matches [191099] (1 species)
   not a true protein

7. Species Rhodothermus marinus [TaxId:29549] [189091] (9 PDB entries)

8. Domain d2y64a1: 2y64 A:1-166 [195848]
   Other proteins in same PDB: d2y64a2
   automated match to d3jxsa_
   complexed with ca

Details for d2y64a1

PDB Entry: 2y64, 1.4 Å

PDB Description: xylopentaose binding mutated (x-2 l110f) cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d2y64a1:

Sequence; same for both SEQRES and ATOM records:

>d2y64a1 b.18.1.14 (A:1-166) automated matches {Rhodothermus marinus [TaxId: 29549]}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpfniqatalpvnvrpgvtytytiraraeqdgavvsftvgnqsfdeygrlhhqq
ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglaivd

Timeline for d2y64a1:

• d2y64a1 first appeared in SCOPe 2.02, called d2y64a_
  
• d2y64a1 appears in SCOPe 2.07