Lineage for d2y64a_ (2y64 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1116326Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1116327Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1116729Family b.18.1.14: CBM4/9 [74893] (4 proteins)
  6. 1116743Protein automated matches [191099] (1 species)
    not a true protein
  7. 1116744Species Rhodothermus marinus [TaxId:29549] [189091] (7 PDB entries)
  8. 1116749Domain d2y64a_: 2y64 A: [195848]
    automated match to d3jxsa_
    complexed with ca

Details for d2y64a_

PDB Entry: 2y64 (more details), 1.4 Å

PDB Description: xylopentaose binding mutated (x-2 l110f) cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d2y64a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y64a_ b.18.1.14 (A:) automated matches {Rhodothermus marinus [TaxId: 29549]}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpfniqatalpvnvrpgvtytytiraraeqdgavvsftvgnqsfdeygrlhhqq
ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglaivdl

SCOPe Domain Coordinates for d2y64a_:

Click to download the PDB-style file with coordinates for d2y64a_.
(The format of our PDB-style files is described here.)

Timeline for d2y64a_: