SCOPe 2.02: Domain d4dq1a_: 4dq1 A:

Lineage for d4dq1a_ (4dq1 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family)

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [195805] (1 PDB entry)

8. Domain d4dq1a_: 4dq1 A: [195807]
   automated match to d1tsla_
   complexed with ump

Details for d4dq1a_

PDB Entry: 4dq1, 2.71 Å

PDB Description: thymidylate synthase from staphylococcus aureus.

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4dq1a_:

Sequence; same for both SEQRES and ATOM records:

>d4dq1a_ d.117.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
nsfdaayhslceevleigntrndrtntgtiskfghqlrfdlskgfpllttkkvsfklvat
ellwfikgdtniqyllkynnniwnewafenyiksdeyngpdmtdfghralsdpefneqyk
eqmkqfkqrileddtfakqfgdlgnvygkqwrdwvdkdgnhfdqlktvieqikhnpdsrr
hivsawnpteidtmalppchtmfqfyvqdgklscqlyqrsadiflgvpfniasyallthl
iakecglevgefvhtfgdahiysnhidaiqtqlaresfnpptlkinsdksifdinyedle
ivdyeshpaika

Timeline for d4dq1a_:

• d4dq1a_ is new in SCOPe 2.02-stable
  
• d4dq1a_ appears in SCOPe 2.03
  
• d4dq1a_ appears in the current release, SCOPe 2.08