SCOPe 2.08: Domain d3s53b_: 3s53 B:

Lineage for d3s53b_ (3s53 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3s53b_: 3s53 B: [195775]
   automated match to d2hs1a_
   complexed with 017, iod, po4; mutant

Details for d3s53b_

PDB Entry: 3s53, 1.5 Å

PDB Description: HIV-1 protease triple mutants V32I, I47V, V82I with antiviral drug darunavir in space group P212121

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3s53b_:

Sequence; same for both SEQRES and ATOM records:

>d3s53b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtiieemslpgrwkpkmvggiggfikvrqyd
qiiieiaghkaigtvlvgptpiniigrnlltqigatlnf

Timeline for d3s53b_:

• d3s53b_ first appeared in SCOPe 2.02
  
• d3s53b_ appears in SCOPe 2.07