SCOPe 2.07: Domain d3u43b_: 3u43 B:

Lineage for d3u43b_ (3u43 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein automated matches [190311] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)

8. Domain d3u43b_: 3u43 B: [195765]
   Other proteins in same PDB: d3u43a1, d3u43a2
   automated match to d1fsjb_
   complexed with ca, zn

Details for d3u43b_

PDB Entry: 3u43, 1.72 Å

PDB Description: Crystal structure of the colicin E2 DNase-Im2 complex

PDB Compounds: (B:) Colicin-E2

SCOPe Domain Sequences for d3u43b_:

Sequence; same for both SEQRES and ATOM records:

>d3u43b_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
skrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefknfddfrkkfweevs
kdpdlskqfkgsnktniqkgkapfarkkdqvggrerfelhhdkpisqdggvydmnnirvt
tpkrhidihrgk

Timeline for d3u43b_:

• d3u43b_ first appeared in SCOPe 2.02
  
• d3u43b_ appears in SCOPe 2.06
  
• d3u43b_ appears in the current release, SCOPe 2.08