Lineage for d3u43b_ (3u43 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1192553Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 1192554Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 1192555Family d.4.1.1: HNH-motif [54061] (3 proteins)
  6. 1192602Protein automated matches [190311] (1 species)
    not a true protein
  7. 1192603Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)
  8. 1192605Domain d3u43b_: 3u43 B: [195765]
    Other proteins in same PDB: d3u43a_
    automated match to d1fsjb_
    complexed with ca, zn

Details for d3u43b_

PDB Entry: 3u43 (more details), 1.72 Å

PDB Description: Crystal structure of the colicin E2 DNase-Im2 complex
PDB Compounds: (B:) Colicin-E2

SCOPe Domain Sequences for d3u43b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u43b_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
skrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefknfddfrkkfweevs
kdpdlskqfkgsnktniqkgkapfarkkdqvggrerfelhhdkpisqdggvydmnnirvt
tpkrhidihrgk

SCOPe Domain Coordinates for d3u43b_:

Click to download the PDB-style file with coordinates for d3u43b_.
(The format of our PDB-style files is described here.)

Timeline for d3u43b_: