Lineage for d1aokb_ (1aok B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1282888Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1282889Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1282894Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1283002Protein Snake phospholipase A2 [48624] (36 species)
  7. 1283151Species Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId:8704] [88518] (2 PDB entries)
  8. 1283153Domain d1aokb_: 1aok B: [19561]
    complex with inhibitory subunit
    complexed with act

Details for d1aokb_

PDB Entry: 1aok (more details), 2 Å

PDB Description: vipoxin complex
PDB Compounds: (B:) vipoxin complex

SCOPe Domain Sequences for d1aokb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aokb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId: 8704]}
nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
laiyyysfkkgnivcgknngclrdicecdrvaancfhqnkntynanykflsssrcrqtge
kc

SCOPe Domain Coordinates for d1aokb_:

Click to download the PDB-style file with coordinates for d1aokb_.
(The format of our PDB-style files is described here.)

Timeline for d1aokb_: