Lineage for d1aokb_ (1aok B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Snake phospholipase A2 [48624] (12 species) 
Species Sand viper (Vipera ammodytes meridionalis), vipoxin [48635] (2 PDB entries) 
Domain d1aokb_: 1aok B: [19561]
Details for d1aokb_
PDB Entry: 1aok (more details), 2 Å
PDB Description: vipoxin complex
SCOP Domain Sequences for d1aokb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aokb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin}
nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
laiyyysfkkgnivcgknngclrdicecdrvaancfhqnkntynanykflsssrcrqtge
kc
SCOP Domain Coordinates for d1aokb_:
Click to download the PDB-style file with coordinates for d1aokb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aokb_:
- d1aokb_ appears in SCOP 1.57
- d1aokb_ appears in the current release, SCOPe 2.08
View in 3D
