SCOPe 2.08: Domain d1aokb_: 1aok B:

Lineage for d1aokb_ (1aok B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId:8704] [88518] (2 PDB entries)

8. Domain d1aokb_: 1aok B: [19561]
   complex with inhibitory subunit
   complexed with act

Details for d1aokb_

PDB Entry: 1aok, 2 Å

PDB Description: vipoxin complex

PDB Compounds: (B:) vipoxin complex

SCOPe Domain Sequences for d1aokb_:

Sequence; same for both SEQRES and ATOM records:

>d1aokb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId: 8704]}
nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
laiyyysfkkgnivcgknngclrdicecdrvaancfhqnkntynanykflsssrcrqtge
kc

Timeline for d1aokb_:

• d1aokb_ first appeared (with stable ids) in SCOP 1.55
  
• d1aokb_ appears in SCOPe 2.07