SCOPe 2.04: Domain d3t90a_: 3t90 A:

Lineage for d3t90a_ (3t90 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (28 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [195601] (1 PDB entry)

8. Domain d3t90a_: 3t90 A: [195604]
   automated match to d1i21y_
   complexed with epe, na

Details for d3t90a_

PDB Entry: 3t90, 1.5 Å

PDB Description: Crystal structure of glucosamine-6-phosphate N-acetyltransferase from Arabidopsis thaliana

PDB Compounds: (A:) Glucose-6-phosphate acetyltransferase 1

SCOPe Domain Sequences for d3t90a_:

Sequence; same for both SEQRES and ATOM records:

>d3t90a_ d.108.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
etfkirkleisdkrkgfiellgqltvtgsvtdeefdrrfeeirsygddhvicvieeetsg
kiaatgsvmiekkflrncgkaghiedvvvdsrfrgkqlgkkvveflmdhcksmgcykvil
dcsvenkvfyekcgmsnksiqmskyfd

Timeline for d3t90a_:

• d3t90a_ first appeared in SCOPe 2.02
  
• d3t90a_ appears in SCOPe 2.03
  
• d3t90a_ appears in SCOPe 2.05
  
• d3t90a_ appears in the current release, SCOPe 2.08