![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (32 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [195601] (1 PDB entry) |
![]() | Domain d3t90a_: 3t90 A: [195604] automated match to d1i21y_ complexed with epe, na |
PDB Entry: 3t90 (more details), 1.5 Å
SCOPe Domain Sequences for d3t90a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t90a_ d.108.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} etfkirkleisdkrkgfiellgqltvtgsvtdeefdrrfeeirsygddhvicvieeetsg kiaatgsvmiekkflrncgkaghiedvvvdsrfrgkqlgkkvveflmdhcksmgcykvil dcsvenkvfyekcgmsnksiqmskyfd
Timeline for d3t90a_: