SCOPe 2.04: Domain d3ubub_: 3ubu B:

Lineage for d3ubub_ (3ubu B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (7 species)
   not a true protein

7. Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [195597] (1 PDB entry)

8. Domain d3ubub_: 3ubu B: [195598]
   automated match to d1c3ab_
   complexed with gol, so4

Details for d3ubub_

PDB Entry: 3ubu, 1.91 Å

PDB Description: Crystal structure of agkisacucetin, a GpIb-binding snaclec (snake C-type lectin) that inhibits platelet

PDB Compounds: (B:) Agglucetin subunit beta-2

SCOPe Domain Sequences for d3ubub_:

Sequence; same for both SEQRES and ATOM records:

>d3ubub_ d.169.1.1 (B:) automated matches {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]}
gfccplrwsayeghcylvvkekktwddaekfcteqrkgghlvsvhsreeadflvhlaypi
ldlsliwmglsnmwndckrewsdgtkldfkswaktsdcligktdgdnqwlnmdcskkhyf
vckfkl

Timeline for d3ubub_:

• d3ubub_ first appeared in SCOPe 2.02
  
• d3ubub_ appears in SCOPe 2.03
  
• d3ubub_ appears in SCOPe 2.05
  
• d3ubub_ appears in the current release, SCOPe 2.08