Lineage for d3ubub_ (3ubu B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442983Protein automated matches [190329] (6 species)
    not a true protein
  7. 1443023Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [195597] (1 PDB entry)
  8. 1443025Domain d3ubub_: 3ubu B: [195598]
    automated match to d1c3ab_
    complexed with gol, so4

Details for d3ubub_

PDB Entry: 3ubu (more details), 1.91 Å

PDB Description: Crystal structure of agkisacucetin, a GpIb-binding snaclec (snake C-type lectin) that inhibits platelet
PDB Compounds: (B:) Agglucetin subunit beta-2

SCOPe Domain Sequences for d3ubub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubub_ d.169.1.1 (B:) automated matches {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]}
gfccplrwsayeghcylvvkekktwddaekfcteqrkgghlvsvhsreeadflvhlaypi
ldlsliwmglsnmwndckrewsdgtkldfkswaktsdcligktdgdnqwlnmdcskkhyf
vckfkl

SCOPe Domain Coordinates for d3ubub_:

Click to download the PDB-style file with coordinates for d3ubub_.
(The format of our PDB-style files is described here.)

Timeline for d3ubub_: