![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein automated matches [190329] (6 species) not a true protein |
![]() | Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [195597] (1 PDB entry) |
![]() | Domain d3ubub_: 3ubu B: [195598] automated match to d1c3ab_ complexed with gol, so4 |
PDB Entry: 3ubu (more details), 1.91 Å
SCOPe Domain Sequences for d3ubub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubub_ d.169.1.1 (B:) automated matches {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]} gfccplrwsayeghcylvvkekktwddaekfcteqrkgghlvsvhsreeadflvhlaypi ldlsliwmglsnmwndckrewsdgtkldfkswaktsdcligktdgdnqwlnmdcskkhyf vckfkl
Timeline for d3ubub_: