SCOPe 2.08: Domain d3sfva1: 3sfv A:1-176

Lineage for d3sfva1 (3sfv A:1-176)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d3sfva1: 3sfv A:1-176 [195572]
   Other proteins in same PDB: d3sfva2
   automated match to d2fola1
   complexed with gdp; mutant

Details for d3sfva1

PDB Entry: 3sfv, 1.73 Å

PDB Description: Crystal structure of the GDP-bound Rab1a S25N mutant in complex with the coiled-coil domain of LidA from Legionella pneumophila

PDB Compounds: (A:) Ras-related protein Rab-1A

SCOPe Domain Sequences for d3sfva1:

Sequence; same for both SEQRES and ATOM records:

>d3sfva1 c.37.1.8 (A:1-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mssmnpeydylfkllligdsgvgknclllrfaddtytesyistigvdfkirtieldgkti
klqiwdtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkl
lvgnkcdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm

Timeline for d3sfva1:

• d3sfva1 first appeared in SCOPe 2.02, called d3sfva_
  
• d3sfva1 appears in SCOPe 2.07