Lineage for d3tvji_ (3tvj I:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032081Fold g.4: PMP inhibitors [57282] (1 superfamily)
    disulfide-rich fold; all-beta: 3 antiparallel strands
  4. 3032082Superfamily g.4.1: PMP inhibitors [57283] (2 families) (S)
    automatically mapped to Pfam PF05375
  5. 3032083Family g.4.1.1: PMP inhibitors [57284] (5 proteins)
  6. 3032101Protein automated matches [195505] (2 species)
    not a true protein
  7. 3032102Species Desert locust (Schistocerca gregaria) [TaxId:7010] [195527] (1 PDB entry)
  8. 3032103Domain d3tvji_: 3tvj I: [195528]
    automated match to d1kioa_
    complexed with so4

Details for d3tvji_

PDB Entry: 3tvj (more details), 1.28 Å

PDB Description: Catalytic fragment of MASP-2 in complex with its specific inhibitor developed by directed evolution on SGCI scaffold
PDB Compounds: (I:) Protease inhibitor SGPI-2

SCOPe Domain Sequences for d3tvji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tvji_ g.4.1.1 (I:) automated matches {Desert locust (Schistocerca gregaria) [TaxId: 7010]}
evtcepgttfkdkcntcrcgsdgksavctklwcnq

SCOPe Domain Coordinates for d3tvji_:

Click to download the PDB-style file with coordinates for d3tvji_.
(The format of our PDB-style files is described here.)

Timeline for d3tvji_: