Class g: Small proteins [56992] (100 folds) |
Fold g.4: PMP inhibitors [57282] (1 superfamily) disulfide-rich fold; all-beta: 3 antiparallel strands |
Superfamily g.4.1: PMP inhibitors [57283] (2 families) automatically mapped to Pfam PF05375 |
Family g.4.1.1: PMP inhibitors [57284] (5 proteins) |
Protein automated matches [195505] (2 species) not a true protein |
Species Desert locust (Schistocerca gregaria) [TaxId:7010] [195527] (1 PDB entry) |
Domain d3tvji_: 3tvj I: [195528] automated match to d1kioa_ complexed with so4 |
PDB Entry: 3tvj (more details), 1.28 Å
SCOPe Domain Sequences for d3tvji_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvji_ g.4.1.1 (I:) automated matches {Desert locust (Schistocerca gregaria) [TaxId: 7010]} evtcepgttfkdkcntcrcgsdgksavctklwcnq
Timeline for d3tvji_: