Class g: Small proteins [56992] (100 folds) |
Fold g.4: PMP inhibitors [57282] (1 superfamily) disulfide-rich fold; all-beta: 3 antiparallel strands |
Superfamily g.4.1: PMP inhibitors [57283] (2 families) automatically mapped to Pfam PF05375 |
Family g.4.1.1: PMP inhibitors [57284] (5 proteins) |
Protein Protease inhibitor SGCI [69945] (1 species) |
Species Desert locust (Schistocerca gregaria) [TaxId:7010] [69946] (2 PDB entries) |
Domain d1kioa_: 1kio A: [68633] |
PDB Entry: 1kio (more details)
SCOPe Domain Sequences for d1kioa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kioa_ g.4.1.1 (A:) Protease inhibitor SGCI {Desert locust (Schistocerca gregaria) [TaxId: 7010]} evtcepgttfkdkcntcrcgsdgksaactrmacpq
Timeline for d1kioa_: