Lineage for d3rkqb_ (3rkq B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1257873Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1258062Protein automated matches [190360] (2 species)
    not a true protein
  7. 1258072Species Human (Homo sapiens) [TaxId:9606] [188758] (3 PDB entries)
  8. 1258074Domain d3rkqb_: 3rkq B: [195444]
    automated match to d1ftta_
    protein/DNA complex; complexed with mg

Details for d3rkqb_

PDB Entry: 3rkq (more details), 1.7 Å

PDB Description: NKX2.5 Homeodomain dimer bound to ANF-242 DNA
PDB Compounds: (B:) Homeobox protein Nkx-2.5

SCOPe Domain Sequences for d3rkqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rkqb_ a.4.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grrkprvlfsqaqvyelerrfkqqrylsaperdqlasvlkltstqvkiwfqnrryks

SCOPe Domain Coordinates for d3rkqb_:

Click to download the PDB-style file with coordinates for d3rkqb_.
(The format of our PDB-style files is described here.)

Timeline for d3rkqb_: