Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein automated matches [190360] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188758] (3 PDB entries) |
Domain d3rkqb_: 3rkq B: [195444] automated match to d1ftta_ protein/DNA complex; complexed with mg |
PDB Entry: 3rkq (more details), 1.7 Å
SCOPe Domain Sequences for d3rkqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rkqb_ a.4.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} grrkprvlfsqaqvyelerrfkqqrylsaperdqlasvlkltstqvkiwfqnrryks
Timeline for d3rkqb_: