SCOPe 2.08: Domain d3rkqb1: 3rkq B:138-193

Lineage for d3rkqb1 (3rkq B:138-193)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein automated matches [190360] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)

8. Domain d3rkqb1: 3rkq B:138-193 [195444]
   Other proteins in same PDB: d3rkqa2, d3rkqb2
   automated match to d1ftta_
   protein/DNA complex; complexed with mg

Details for d3rkqb1

PDB Entry: 3rkq, 1.7 Å

PDB Description: NKX2.5 Homeodomain dimer bound to ANF-242 DNA

PDB Compounds: (B:) Homeobox protein Nkx-2.5

SCOPe Domain Sequences for d3rkqb1:

Sequence; same for both SEQRES and ATOM records:

>d3rkqb1 a.4.1.1 (B:138-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrkprvlfsqaqvyelerrfkqqrylsaperdqlasvlkltstqvkiwfqnrryks

Timeline for d3rkqb1:

• d3rkqb1 first appeared in SCOPe 2.02, called d3rkqb_
  
• d3rkqb1 appears in SCOPe 2.07