Lineage for d3vich_ (3vic H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940361Species Coral (Montipora efflorescens) [TaxId:105610] [188535] (3 PDB entries)
  8. 2940377Domain d3vich_: 3vic H: [195204]
    automated match to d2p4md_
    complexed with cl, iod

Details for d3vich_

PDB Entry: 3vic (more details), 2.2 Å

PDB Description: green-fluorescent variant of the non-fluorescent chromoprotein rtms5
PDB Compounds: (H:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d3vich_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vich_ d.22.1.1 (H:) automated matches {Coral (Montipora efflorescens) [TaxId: 105610]}
sviatqmtykvymsgtvnghyfevegdgkgrpyegeqtvkltvtkggplpfawdilspqc
xsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkfsgl
nfppngpvmqkktqgwephserlfarggmlignnfmalkleggghylcefkttykakkpv
kmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva

SCOPe Domain Coordinates for d3vich_:

Click to download the PDB-style file with coordinates for d3vich_.
(The format of our PDB-style files is described here.)

Timeline for d3vich_: