SCOPe 2.08: Structural Classification of Proteins

PDB entry 3vic

View 3vic on RCSB PDB site
Description: Green-fluorescent variant of the non-fluorescent chromoprotein Rtms5
Class: fluorescent protein
Keywords: Beta Barrel, Beta Can, GFP, Pocilloporin, Chromoprotein, Pigment, Fluorescent, Anthozoa, Acylimine, Peptide-derived chromophore, FLUORESCENT PROTEIN
Deposited on 2011-09-28, released 2012-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: GFP-like non-fluorescent chromoprotein
Species: Montipora efflorescens [TaxId:105610]
Database cross-references and differences (RAF-indexed):
- Uniprot P83690 (Start-237)
  - chromophore (80)
Domains in SCOPe 2.08: d3vica_
Chain 'B':
Compound: GFP-like non-fluorescent chromoprotein
Species: Montipora efflorescens [TaxId:105610]
Database cross-references and differences (RAF-indexed):
- Uniprot P83690 (19-237)
  - chromophore (80)
Domains in SCOPe 2.08: d3vicb_
Chain 'C':
Compound: GFP-like non-fluorescent chromoprotein
Species: Montipora efflorescens [TaxId:105610]
Database cross-references and differences (RAF-indexed):
- Uniprot P83690 (19-237)
  - chromophore (80)
Domains in SCOPe 2.08: d3vicc_
Chain 'D':
Compound: GFP-like non-fluorescent chromoprotein
Species: Montipora efflorescens [TaxId:105610]
Database cross-references and differences (RAF-indexed):
- Uniprot P83690 (19-237)
  - chromophore (80)
Domains in SCOPe 2.08: d3vicd_
Chain 'E':
Compound: GFP-like non-fluorescent chromoprotein
Species: Montipora efflorescens [TaxId:105610]
Database cross-references and differences (RAF-indexed):
- Uniprot P83690 (Start-237)
  - chromophore (80)
Domains in SCOPe 2.08: d3vice_
Chain 'F':
Compound: GFP-like non-fluorescent chromoprotein
Species: Montipora efflorescens [TaxId:105610]
Database cross-references and differences (RAF-indexed):
- Uniprot P83690 (19-237)
  - chromophore (80)
Domains in SCOPe 2.08: d3vicf_
Chain 'G':
Compound: GFP-like non-fluorescent chromoprotein
Species: Montipora efflorescens [TaxId:105610]
Database cross-references and differences (RAF-indexed):
- Uniprot P83690 (19-237)
  - chromophore (80)
Domains in SCOPe 2.08: d3vicg_
Chain 'H':
Compound: GFP-like non-fluorescent chromoprotein
Species: Montipora efflorescens [TaxId:105610]
Database cross-references and differences (RAF-indexed):
- Uniprot P83690 (Start-237)
  - chromophore (80)
Domains in SCOPe 2.08: d3vich_
Heterogens: IOD, CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3vicA (A:)
mrgshhhhhhtdpssrsktmsviatqmtykvymsgtvnghyfevegdgkgrpyegeqtvk
ltvtkggplpfawdilspqcxsipftkypedipdyvkqsfpegftwerimnfedgavctv
sndssiqgncftyhvkfsglnfppngpvmqkktqgwephserlfarggmlignnfmalkl
eggghylcefkttykakkpvkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva