Class a: All alpha proteins [46456] (290 folds) |
Fold a.131: Peridinin-chlorophyll protein [48607] (1 superfamily) multihelical: forms a boat-shaped protein shell around cofactors |
Superfamily a.131.1: Peridinin-chlorophyll protein [48608] (1 family) duplication: consists of two 8-helical repeats automatically mapped to Pfam PF02429 |
Family a.131.1.1: Peridinin-chlorophyll protein [48609] (1 protein) |
Protein Peridinin-chlorophyll protein [48610] (1 species) soluble light harvesting protein |
Species Dinoflagellate (Amphidinium carterae) [TaxId:2961] [48611] (1 PDB entry) |
Domain d1ppro2: 1ppr O:157-312 [19507] CASP2 complexed with cla, dgd, pid |
PDB Entry: 1ppr (more details), 2 Å
SCOPe Domain Sequences for d1ppro2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ppro2 a.131.1.1 (O:157-312) Peridinin-chlorophyll protein {Dinoflagellate (Amphidinium carterae) [TaxId: 2961]} patvpsgdkigvaaqqlseasypflkeidwlsdvymkplpgvsaqqslkaidkmivmgaq adgnalkaaaeahhkaigsidatgvtsaadyaavnaalgrviasvpkstvmdvynamagv tdtsiplnmfskvnpldanaaakafytfkdvvqaaq
Timeline for d1ppro2:
View in 3D Domains from other chains: (mouse over for more information) d1pprm1, d1pprm2, d1pprn1, d1pprn2 |