SCOPe 2.08: Domain d1pprn2: 1ppr N:157-312

Lineage for d1pprn2 (1ppr N:157-312)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.131: Peridinin-chlorophyll protein [48607] (1 superfamily)
   multihelical: forms a boat-shaped protein shell around cofactors

4. Superfamily a.131.1: Peridinin-chlorophyll protein [48608] (1 family)
   duplication: consists of two 8-helical repeats
   automatically mapped to Pfam PF02429

5. Family a.131.1.1: Peridinin-chlorophyll protein [48609] (1 protein)

6. Protein Peridinin-chlorophyll protein [48610] (1 species)
   soluble light harvesting protein

7. Species Dinoflagellate (Amphidinium carterae) [TaxId:2961] [48611] (1 PDB entry)

8. Domain d1pprn2: 1ppr N:157-312 [19505]
   CASP2
   complexed with cla, dgd, pid

Details for d1pprn2

PDB Entry: 1ppr, 2 Å

PDB Description: peridinin-chlorophyll-protein of amphidinium carterae

PDB Compounds: (N:) peridinin-chlorophyll protein

SCOPe Domain Sequences for d1pprn2:

Sequence; same for both SEQRES and ATOM records:

>d1pprn2 a.131.1.1 (N:157-312) Peridinin-chlorophyll protein {Dinoflagellate (Amphidinium carterae) [TaxId: 2961]}
patvpsgdkigvaaqqlseasypflkeidwlsdvymkplpgvsaqqslkaidkmivmgaq
adgnalkaaaeahhkaigsidatgvtsaadyaavnaalgrviasvpkstvmdvynamagv
tdtsiplnmfskvnpldanaaakafytfkdvvqaaq

Timeline for d1pprn2:

• d1pprn2 first appeared (with stable ids) in SCOP 1.55
  
• d1pprn2 appears in SCOPe 2.07