Lineage for d3vbgc_ (3vbg C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1088952Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1088953Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1088954Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam PF02201
  6. 1088961Protein MDM2 [47594] (2 species)
  7. 1088965Species Human (Homo sapiens) [TaxId:9606] [47596] (25 PDB entries)
  8. 1089003Domain d3vbgc_: 3vbg C: [195029]
    automated match to d1rv1a_
    complexed with 03m

Details for d3vbgc_

PDB Entry: 3vbg (more details), 2.8 Å

PDB Description: structure of hdm2 with dimer inducing indolyl hydantoin ro-2443
PDB Compounds: (C:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d3vbgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vbgc_ a.42.1.1 (C:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
tlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
fgvpsfsvkehrkiytmiyrnlvv

SCOPe Domain Coordinates for d3vbgc_:

Click to download the PDB-style file with coordinates for d3vbgc_.
(The format of our PDB-style files is described here.)

Timeline for d3vbgc_: