Lineage for d3sj4x_ (3sj4 X:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347199Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2347288Protein automated matches [190934] (3 species)
    not a true protein
  7. 2347294Species Geobacter sulfurreducens [TaxId:35554] [189147] (10 PDB entries)
  8. 2347297Domain d3sj4x_: 3sj4 X: [195007]
    automated match to d1os6a_
    complexed with dxc, hem, so4; mutant

Details for d3sj4x_

PDB Entry: 3sj4 (more details), 1.9 Å

PDB Description: ppca mutant m58k
PDB Compounds: (X:) cytochrome c7

SCOPe Domain Sequences for d3sj4x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sj4x_ a.138.1.1 (X:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
addivlkakngdvkfphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheekkk
gptkcgechkk

SCOPe Domain Coordinates for d3sj4x_:

Click to download the PDB-style file with coordinates for d3sj4x_.
(The format of our PDB-style files is described here.)

Timeline for d3sj4x_: