SCOPe 2.02: Domain d3sj4x_: 3sj4 X:

Lineage for d3sj4x_ (3sj4 X:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein automated matches [190934] (2 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [189147] (13 PDB entries)

8. Domain d3sj4x_: 3sj4 X: [195007]
   automated match to d1os6a_
   complexed with dxc, hem, so4; mutant

Details for d3sj4x_

PDB Entry: 3sj4, 1.9 Å

PDB Description: ppca mutant m58k

PDB Compounds: (X:) cytochrome c7

SCOPe Domain Sequences for d3sj4x_:

Sequence; same for both SEQRES and ATOM records:

>d3sj4x_ a.138.1.1 (X:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
addivlkakngdvkfphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheekkk
gptkcgechkk

Timeline for d3sj4x_:

• d3sj4x_ is new in SCOPe 2.02-stable
  
• d3sj4x_ appears in SCOPe 2.03
  
• d3sj4x_ appears in the current release, SCOPe 2.08