Lineage for d4atfb_ (4atf B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779081Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2779165Protein automated matches [191047] (8 species)
    not a true protein
  7. 2779185Species Zobellia galactanivorans [TaxId:63186] [194909] (1 PDB entry)
  8. 2779187Domain d4atfb_: 4atf B: [194911]
    Other proteins in same PDB: d4atfc2, d4atfd2
    automated match to d1o4zb_
    complexed with na; mutant

Details for d4atfb_

PDB Entry: 4atf (more details), 1.9 Å

PDB Description: crystal structure of inactivated mutant beta-agarase b in complex with agaro-octaose
PDB Compounds: (B:) beta-agarase B

SCOPe Domain Sequences for d4atfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4atfb_ b.29.1.2 (B:) automated matches {Zobellia galactanivorans [TaxId: 63186]}
vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
saddtqeidildaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek

SCOPe Domain Coordinates for d4atfb_:

Click to download the PDB-style file with coordinates for d4atfb_.
(The format of our PDB-style files is described here.)

Timeline for d4atfb_: