Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins) Pfam PF00722 beta-Glucanase-like |
Protein automated matches [191047] (8 species) not a true protein |
Species Zobellia galactanivorans [TaxId:63186] [194909] (1 PDB entry) |
Domain d4atfb_: 4atf B: [194911] Other proteins in same PDB: d4atfc2, d4atfd2 automated match to d1o4zb_ complexed with na; mutant |
PDB Entry: 4atf (more details), 1.9 Å
SCOPe Domain Sequences for d4atfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4atfb_ b.29.1.2 (B:) automated matches {Zobellia galactanivorans [TaxId: 63186]} vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll saddtqeidildaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek
Timeline for d4atfb_: