SCOPe 2.08: Domain d4atfc1: 4atf C:58-353

Lineage for d4atfc1 (4atf C:58-353)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
   Pfam PF00722
   beta-Glucanase-like

6. Protein automated matches [191047] (8 species)
   not a true protein

7. Species Zobellia galactanivorans [TaxId:63186] [194909] (1 PDB entry)

8. Domain d4atfc1: 4atf C:58-353 [194910]
   Other proteins in same PDB: d4atfc2, d4atfd2
   automated match to d1o4zb_
   complexed with na; mutant

Details for d4atfc1

PDB Entry: 4atf, 1.9 Å

PDB Description: crystal structure of inactivated mutant beta-agarase b in complex with agaro-octaose

PDB Compounds: (C:) beta-agarase B

SCOPe Domain Sequences for d4atfc1:

Sequence; same for both SEQRES and ATOM records:

>d4atfc1 b.29.1.2 (C:58-353) automated matches {Zobellia galactanivorans [TaxId: 63186]}
vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
saddtqeidildaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek

Timeline for d4atfc1:

• d4atfc1 first appeared in SCOPe 2.02, called d4atfc_
  
• d4atfc1 appears in SCOPe 2.07