| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins) Pfam PF00722 beta-Glucanase-like |
| Protein automated matches [191047] (8 species) not a true protein |
| Species Zobellia galactanivorans [TaxId:63186] [194909] (1 PDB entry) |
| Domain d4atfd1: 4atf D:58-353 [201527] Other proteins in same PDB: d4atfc2, d4atfd2 automated match to d4atfc_ complexed with na; mutant |
PDB Entry: 4atf (more details), 1.9 Å
SCOPe Domain Sequences for d4atfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4atfd1 b.29.1.2 (D:58-353) automated matches {Zobellia galactanivorans [TaxId: 63186]}
vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
saddtqeidildaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek
Timeline for d4atfd1:
View in 3DDomains from other chains: (mouse over for more information) d4atfa_, d4atfb_, d4atfc1, d4atfc2 |