Lineage for d3ut5e_ (3ut5 E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505912Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1506079Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 1506080Family a.137.10.1: Stathmin [101495] (1 protein)
  6. 1506081Protein Stathmin 4 [101496] (1 species)
  7. 1506082Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (25 PDB entries)
  8. 1506101Domain d3ut5e_: 3ut5 E: [194854]
    Other proteins in same PDB: d3ut5a1, d3ut5a2, d3ut5b1, d3ut5b2, d3ut5c1, d3ut5c2, d3ut5d1, d3ut5d2
    automated match to d3ryce_
    complexed with gdp, gtp, loc, mg, so4

Details for d3ut5e_

PDB Entry: 3ut5 (more details), 2.73 Å

PDB Description: Tubulin-Colchicine-Ustiloxin: Stathmin-like domain complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d3ut5e_:

Sequence, based on SEQRES records: (download)

>d3ut5e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrky
qeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerl
qekdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d3ut5e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
admevielnkatsgqswevilkppsfdgvperrrdpsleeiqkkleaaeerrkyqeaell
khlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkh
aeevrknkelke

SCOPe Domain Coordinates for d3ut5e_:

Click to download the PDB-style file with coordinates for d3ut5e_.
(The format of our PDB-style files is described here.)

Timeline for d3ut5e_: