SCOPe 2.03: Domain d4efva_: 4efv A:

Lineage for d4efva_ (4efv A:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.3: Neurotrophin [57520] (5 proteins)
   automatically mapped to Pfam PF00243

6. Protein automated matches [190424] (4 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [194795] (1 PDB entry)

8. Domain d4efva_: 4efv A: [194797]
   automated match to d1wwww_
   complexed with cl, po4

Details for d4efva_

PDB Entry: 4efv, 2.32 Å

PDB Description: Crystal structure of OIF from Llama seminal plasma

PDB Compounds: (A:) Ovulation-inducing factor (OIF)

SCOPe Domain Sequences for d4efva_:

Sequence, based on SEQRES records:

>d4efva_ g.17.1.3 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
rgefsvcdsvsvwvadkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvasgc
rgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlskka

Sequence, based on observed residues (ATOM records):

>d4efva_ g.17.1.3 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
rgefsvcdsvsvwvadkttatdikgkevmvlgevninnsvfkqyffetkcrdpgcrgids
khwnsycttthtfvkaltmdgkqaawrfiridtacvcvlskka

Timeline for d4efva_:

• d4efva_ first appeared in SCOPe 2.02
  
• d4efva_ appears in SCOPe 2.04
  
• d4efva_ appears in the current release, SCOPe 2.08