| Class g: Small proteins [56992] (90 folds) |
| Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
| Family g.17.1.3: Neurotrophin [57520] (5 proteins) automatically mapped to Pfam PF00243 |
| Protein automated matches [190424] (4 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [194795] (1 PDB entry) |
| Domain d4efva_: 4efv A: [194797] automated match to d1wwww_ complexed with cl, po4 |
PDB Entry: 4efv (more details), 2.32 Å
SCOPe Domain Sequences for d4efva_:
Sequence, based on SEQRES records: (download)
>d4efva_ g.17.1.3 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
rgefsvcdsvsvwvadkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvasgc
rgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlskka
>d4efva_ g.17.1.3 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
rgefsvcdsvsvwvadkttatdikgkevmvlgevninnsvfkqyffetkcrdpgcrgids
khwnsycttthtfvkaltmdgkqaawrfiridtacvcvlskka
Timeline for d4efva_: