Lineage for d4efva_ (4efv A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1242698Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1242699Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1242852Family g.17.1.3: Neurotrophin [57520] (5 proteins)
  6. 1242884Protein automated matches [190424] (4 species)
    not a true protein
  7. 1242888Species Lama glama [TaxId:9844] [194795] (1 PDB entry)
  8. 1242889Domain d4efva_: 4efv A: [194797]
    automated match to d1wwww_
    complexed with cl, po4

Details for d4efva_

PDB Entry: 4efv (more details), 2.32 Å

PDB Description: Crystal structure of OIF from Llama seminal plasma
PDB Compounds: (A:) Ovulation-inducing factor (OIF)

SCOPe Domain Sequences for d4efva_:

Sequence, based on SEQRES records: (download)

>d4efva_ g.17.1.3 (A:) automated matches {Lama glama [TaxId: 9844]}
rgefsvcdsvsvwvadkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvasgc
rgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlskka

Sequence, based on observed residues (ATOM records): (download)

>d4efva_ g.17.1.3 (A:) automated matches {Lama glama [TaxId: 9844]}
rgefsvcdsvsvwvadkttatdikgkevmvlgevninnsvfkqyffetkcrdpgcrgids
khwnsycttthtfvkaltmdgkqaawrfiridtacvcvlskka

SCOPe Domain Coordinates for d4efva_:

Click to download the PDB-style file with coordinates for d4efva_.
(The format of our PDB-style files is described here.)

Timeline for d4efva_: