Lineage for d4efvb_ (4efv B:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1461751Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1461752Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1461909Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 1461944Protein automated matches [190424] (4 species)
    not a true protein
  7. 1461951Species Llama (Lama glama) [TaxId:9844] [194795] (1 PDB entry)
  8. 1461953Domain d4efvb_: 4efv B: [194796]
    automated match to d1wwww_
    complexed with cl, po4

Details for d4efvb_

PDB Entry: 4efv (more details), 2.32 Å

PDB Description: Crystal structure of OIF from Llama seminal plasma
PDB Compounds: (B:) Ovulation-inducing factor (OIF)

SCOPe Domain Sequences for d4efvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4efvb_ g.17.1.3 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
gefsvcdsvsvwvadkttatdikgkevmvlgevninnsvfkqyffetkcrdpnpvasgcr
gidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlskkas

SCOPe Domain Coordinates for d4efvb_:

Click to download the PDB-style file with coordinates for d4efvb_.
(The format of our PDB-style files is described here.)

Timeline for d4efvb_: