Lineage for d4fqia1 (4fqi A:11-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040351Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [190025] (2 PDB entries)
  8. 2040352Domain d4fqia1: 4fqi A:11-324 [194787]
    Other proteins in same PDB: d4fqia2, d4fqib1, d4fqib2, d4fqil1, d4fqil2
    automated match to d3gbma_
    complexed with edo, gol, nag

Details for d4fqia1

PDB Entry: 4fqi (more details), 1.71 Å

PDB Description: Crystal Structure of Fab CR9114 in Complex with a H5N1 influenza virus hemagglutinin
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d4fqia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqia1 b.19.1.2 (A:11-324) Hemagglutinin {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d4fqia1:

Click to download the PDB-style file with coordinates for d4fqia1.
(The format of our PDB-style files is described here.)

Timeline for d4fqia1: