PDB entry 4fqi

View 4fqi on RCSB PDB site
Description: Crystal Structure of Fab CR9114 in Complex with a H5N1 influenza virus hemagglutinin
Class: viral protein/immune system
Keywords: neutralizing antibodies, antibody affinity, antigens, epitopes, glycosylation, hemagglutinin glycoproteins, immunoglobulin Fab fragments, H5N1 subtype, influenza vaccines, avian flu, envelope protein, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-06-25, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.2
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4fqia1, d4fqia2
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:284218]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ33 (0-173)
      • expression tag (174-175)
    Domains in SCOPe 2.07: d4fqib1, d4fqib2
  • Chain 'H':
    Compound: Antibody CR9114 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQI (0-End)
  • Chain 'L':
    Compound: Antibody CR9114 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQI
    Domains in SCOPe 2.07: d4fqil1, d4fqil2
  • Heterogens: EDO, NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fqiA (A:)
    adpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcs
    vagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqi
    ipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlw
    gihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpn
    dainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihp
    ltigecpkyvksnrlvlatglrnspqrerrrkkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqiA (A:)
    dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
    agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
    pksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwg
    ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpnd
    ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
    tigecpkyvksnrlvlatglrnsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fqiB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqiB (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissg
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fqiL (L:)
    qsaltqppavsgtpgqrvtiscsgsdsnigrrsvnwyqqfpgtapklliysndqrpsvvp
    drfsgsksgtsaslaisglqsedeaeyycaawddslkgavfgggtqltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqiL (L:)
    saltqppavsgtpgqrvtiscsgsdsnigrrsvnwyqqfpgtapklliysndqrpsvvpd
    rfsgsksgtsaslaisglqsedeaeyycaawddslkgavfgggtqltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvap