Lineage for d4fqil2 (4fqi L:108-208)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (765 PDB entries)
  8. 2352497Domain d4fqil2: 4fqi L:108-208 [202123]
    Other proteins in same PDB: d4fqia1, d4fqia2, d4fqib1, d4fqib2, d4fqil1
    automated match to d2fb4l2
    complexed with edo, gol, nag

Details for d4fqil2

PDB Entry: 4fqi (more details), 1.71 Å

PDB Description: crystal structure of fab cr9114 in complex with a h5n1 influenza virus hemagglutinin
PDB Compounds: (L:) Antibody CR9114 light chain

SCOPe Domain Sequences for d4fqil2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqil2 b.1.1.2 (L:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d4fqil2:

Click to download the PDB-style file with coordinates for d4fqil2.
(The format of our PDB-style files is described here.)

Timeline for d4fqil2: