SCOPe 2.08: Domain d4g89b1: 4g89 B:1-232

Lineage for d4g89b1 (4g89 B:1-232)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (21 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [193517] (1 PDB entry)

8. Domain d4g89b1: 4g89 B:1-232 [194687]
   Other proteins in same PDB: d4g89a2, d4g89b2
   automated match to d1nc1a_
   complexed with ade, sah, so4

Details for d4g89b1

PDB Entry: 4g89, 2.1 Å

PDB Description: Crystal structure of k. pneumoniae mta/adohcy nucleosidase in complex with fragmented s-adenosyl-l-homocysteine

PDB Compounds: (B:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4g89b1:

Sequence; same for both SEQRES and ATOM records:

>d4g89b1 c.56.2.1 (B:1-232) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mkigiigameeevtllrdkienrqtitiggseiytgqlhgvdvallksgigkvaaamgat
lllercqpdviintgsagglastlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
adeklvaaaescikaldlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfkvpfvvvraisdvadqqshlsfeeflavaarqstlmvenlvqnlarg

Timeline for d4g89b1:

• d4g89b1 first appeared in SCOPe 2.02, called d4g89b_
  
• d4g89b1 appears in SCOPe 2.07