Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein automated matches [190142] (21 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:272620] [193517] (1 PDB entry) |
Domain d4g89a1: 4g89 A:1-232 [193518] Other proteins in same PDB: d4g89a2, d4g89b2 automated match to d1nc1a_ complexed with ade, sah, so4 |
PDB Entry: 4g89 (more details), 2.1 Å
SCOPe Domain Sequences for d4g89a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g89a1 c.56.2.1 (A:1-232) automated matches {Klebsiella pneumoniae [TaxId: 272620]} mkigiigameeevtllrdkienrqtitiggseiytgqlhgvdvallksgigkvaaamgat lllercqpdviintgsagglastlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk adeklvaaaescikaldlnavrglivsgdafingsvglakirhnfpqaiavemeataiah vchnfkvpfvvvraisdvadqqshlsfeeflavaarqstlmvenlvqnlarg
Timeline for d4g89a1: