Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) common fold is elaborated with additional secondary structures |
Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins) |
Protein automated matches [194683] (2 species) not a true protein |
Species Sinorhizobium meliloti [TaxId:266834] [194684] (1 PDB entry) |
Domain d4gwba_: 4gwb A: [194685] automated match to d1nwaa_ complexed with ca, cl |
PDB Entry: 4gwb (more details), 1.2 Å
SCOPe Domain Sequences for d4gwba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gwba_ d.58.28.1 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]} tkravlaggcfwgmqdlirklpgvietrvgytggdvpnatyrnhgthaegieiifdperi syrrilelffqihdpttkdrqgndigtsyrsaiyyvddeqkriaqetiadveasglwpgk vvtevepvrdfweaepehqnylerypngytchfprpnwvlprrs
Timeline for d4gwba_: