Lineage for d4gwba_ (4gwb A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207081Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (1 family) (S)
    common fold is elaborated with additional secondary structures
  5. 1207082Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)
  6. 1207095Protein automated matches [194683] (1 species)
    not a true protein
  7. 1207096Species Sinorhizobium meliloti [TaxId:266834] [194684] (1 PDB entry)
  8. 1207097Domain d4gwba_: 4gwb A: [194685]
    automated match to d1nwaa_
    complexed with ca, cl

Details for d4gwba_

PDB Entry: 4gwb (more details), 1.2 Å

PDB Description: Crystal structure of putative Peptide methionine sulfoxide reductase from Sinorhizobium meliloti 1021
PDB Compounds: (A:) Peptide methionine sulfoxide reductase MsrA 3

SCOPe Domain Sequences for d4gwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gwba_ d.58.28.1 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
tkravlaggcfwgmqdlirklpgvietrvgytggdvpnatyrnhgthaegieiifdperi
syrrilelffqihdpttkdrqgndigtsyrsaiyyvddeqkriaqetiadveasglwpgk
vvtevepvrdfweaepehqnylerypngytchfprpnwvlprrs

SCOPe Domain Coordinates for d4gwba_:

Click to download the PDB-style file with coordinates for d4gwba_.
(The format of our PDB-style files is described here.)

Timeline for d4gwba_: