SCOPe 2.04: Domain d4gb31_: 4gb3 1:

Lineage for d4gb31_ (4gb3 1:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (9 species)
   not a true protein

7. Species Human coxsackievirus B3 [TaxId:12072] [194627] (1 PDB entry)

8. Domain d4gb31_: 4gb3 1: [194628]
   Other proteins in same PDB: d4gb33_
   automated match to d1cov1_
   complexed with myr, plm

Details for d4gb31_

PDB Entry: 4gb3, 2.74 Å

PDB Description: Human coxsackievirus B3 strain RD coat protein

PDB Compounds: (1:) coat protein 1

SCOPe Domain Sequences for d4gb31_:

Sequence; same for both SEQRES and ATOM records:

>d4gb31_ b.121.4.1 (1:) automated matches {Human coxsackievirus B3 [TaxId: 12072]}
aaigrvadtvgtgptnseaipaltaaetghtsqvvpgdtmqtrhvknyhsrsestienfl
crsacvyfteyensgakryaewvitprqaaqlrrklefftyvrfdleltfvitstqqpst
tqnqdaqilthqimyvppggpvpdkvdsyvwqtstnpsvfwtegnapprmsipflsigna
ysnfydgwsefsrngvygintlnnmgtlyarhvnagstgpikstiriyfkpkhvkawipr
pprlcqyekaknvnfqpsgvtttrqsittmtnt

Timeline for d4gb31_:

• d4gb31_ first appeared in SCOPe 2.02
  
• d4gb31_ appears in SCOPe 2.03
  
• d4gb31_ appears in SCOPe 2.05
  
• d4gb31_ appears in the current release, SCOPe 2.08