Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.0: automated matches [191667] (1 protein) not a true family |
Protein automated matches [191267] (6 species) not a true protein |
Species Artificial gene [TaxId:32630] [194542] (2 PDB entries) |
Domain d4hb5b1: 4hb5 B:2-161 [194543] Other proteins in same PDB: d4hb5b2 automated match to d3q9nc_ |
PDB Entry: 4hb5 (more details), 2.29 Å
SCOPe Domain Sequences for d4hb5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hb5b1 d.211.1.0 (B:2-161) automated matches {Artificial gene [TaxId: 32630]} selgkrlieaaengnkdrvkdllengadpnasdsdgrtplhyaaenghkeivklllskga dpnakdsdgrtplhyaaenghkeivklllskgadpnakdsdgrtplhyaaenghkeivkl llskgadpntsdsdgrtpldlarehgneeivkllekqggw
Timeline for d4hb5b1: