Lineage for d4hb5b_ (4hb5 B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1229098Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1229099Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1229217Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 1229218Protein automated matches [191267] (2 species)
    not a true protein
  7. 1229219Species Artificial gene [TaxId:32630] [194542] (1 PDB entry)
  8. 1229221Domain d4hb5b_: 4hb5 B: [194543]
    automated match to d3q9nc_

Details for d4hb5b_

PDB Entry: 4hb5 (more details), 2.29 Å

PDB Description: crystal structure of engineered protein. northeast structural genomics consortium target or267.
PDB Compounds: (B:) Engineered protein

SCOPe Domain Sequences for d4hb5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hb5b_ d.211.1.0 (B:) automated matches {Artificial gene [TaxId: 32630]}
selgkrlieaaengnkdrvkdllengadpnasdsdgrtplhyaaenghkeivklllskga
dpnakdsdgrtplhyaaenghkeivklllskgadpnakdsdgrtplhyaaenghkeivkl
llskgadpntsdsdgrtpldlarehgneeivkllekqggwle

SCOPe Domain Coordinates for d4hb5b_:

Click to download the PDB-style file with coordinates for d4hb5b_.
(The format of our PDB-style files is described here.)

Timeline for d4hb5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4hb5a_