SCOPe 2.02: Domain d4hb5b_: 4hb5 B:

Lineage for d4hb5b_ (4hb5 B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (2 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [194542] (1 PDB entry)

8. Domain d4hb5b_: 4hb5 B: [194543]
   automated match to d3q9nc_

Details for d4hb5b_

PDB Entry: 4hb5, 2.29 Å

PDB Description: crystal structure of engineered protein. northeast structural genomics consortium target or267.

PDB Compounds: (B:) Engineered protein

SCOPe Domain Sequences for d4hb5b_:

Sequence; same for both SEQRES and ATOM records:

>d4hb5b_ d.211.1.0 (B:) automated matches {Artificial gene [TaxId: 32630]}
selgkrlieaaengnkdrvkdllengadpnasdsdgrtplhyaaenghkeivklllskga
dpnakdsdgrtplhyaaenghkeivklllskgadpnakdsdgrtplhyaaenghkeivkl
llskgadpntsdsdgrtpldlarehgneeivkllekqggwle

Timeline for d4hb5b_:

• d4hb5b_ is new in SCOPe 2.02-stable
  
• d4hb5b_ appears in SCOPe 2.03
  
• d4hb5b_ appears in the current release, SCOPe 2.08, called d4hb5b1