Lineage for d4h9sc_ (4h9s C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987252Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1987253Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1987254Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1987576Protein Histone H4 [47125] (7 species)
  7. 1987712Species Human (Homo sapiens) [TaxId:9606] [192456] (15 PDB entries)
  8. 1987720Domain d4h9sc_: 4h9s C: [194488]
    Other proteins in same PDB: d4h9sa_, d4h9sb_
    automated match to d1m18f_
    protein/DNA complex; complexed with po4

Details for d4h9sc_

PDB Entry: 4h9s (more details), 2.6 Å

PDB Description: Complex structure 6 of DAXX/H3.3(sub7)/H4
PDB Compounds: (C:) histone h4

SCOPe Domain Sequences for d4h9sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h9sc_ a.22.1.1 (C:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
qgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtamdv
vyalkrqgrtlygf

SCOPe Domain Coordinates for d4h9sc_:

Click to download the PDB-style file with coordinates for d4h9sc_.
(The format of our PDB-style files is described here.)

Timeline for d4h9sc_: