Lineage for d4hjoa_ (4hjo A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219340Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2219341Species Human (Homo sapiens) [TaxId:9606] [82796] (90 PDB entries)
    Uniprot P00533 702-1018
  8. 2219380Domain d4hjoa_: 4hjo A: [194321]
    automated match to d1m14a_
    complexed with aq4

Details for d4hjoa_

PDB Entry: 4hjo (more details), 2.75 Å

PDB Description: Crystal structure of the inactive EGFR tyrosine kinase domain with erlotinib
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d4hjoa_:

Sequence, based on SEQRES records: (download)

>d4hjoa_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
llrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeilde
ayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqia
kgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwma
lesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictid
vymimrkcwmidadsrpkfreliiefskmardpqrylviqgd

Sequence, based on observed residues (ATOM records): (download)

>d4hjoa_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
llrilketefkkikvlgsgafgtvykglwipvkipvaikelreatspkankeildeayvm
asvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmn
yledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwmalesi
lhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymi
mrkcwmidadsrpkfreliiefskmardpqrylviqgd

SCOPe Domain Coordinates for d4hjoa_:

Click to download the PDB-style file with coordinates for d4hjoa_.
(The format of our PDB-style files is described here.)

Timeline for d4hjoa_: